PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00048g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 373aa    MW: 41763.6 Da    PI: 9.9951
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00048g00004.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM96.93e-3068350128
                       NAM  50 kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               +v ++++ew+fFs+r +ky++g++++rat+sgyWkatgk+++v+s +++l+g+k+tLvf++grapkg++t+W+mhey +
  Niben101Scf00048g00004.1   6 SVIQSDNEWFFFSPRGRKYPNGSQSKRATESGYWKATGKERNVKS-GSNLIGTKRTLVFHTGRAPKGQRTHWIMHEYCM 83 
                               4556789**************************************.9******************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100535.0081140IPR003441NAC domain
SuperFamilySSF1019419.94E-33293IPR003441NAC domain
PfamPF023652.3E-141282IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MLPAKSVIQS DNEWFFFSPR GRKYPNGSQS KRATESGYWK ATGKERNVKS GSNLIGTKRT  60
LVFHTGRAPK GQRTHWIMHE YCMSGNTNYQ KPSPGLDRFR NSIMLPLPHS GDFYYVTTFR  120
TLEIFIAHID SMVVCRLRKN SEFHLNGTPR NQRNQLSATA TATAQSGAGQ LGSLELVTVG  180
GCCCSKEGSS SFYSHSVEQM DSGSESDKPT KEFSQHDSSG HFKDCDGEED WFADIMKDDI  240
IKLDDSSLND QPISMVPSRP ESSISTHEAR AAMSGVAPFQ GTANRRLRLV REKVVVCPVK  300
GSRRYEATKK NKMGVSTSSS GRWLRNMFSV KTMKQYVMPI FLVAFILLVM LLSMLGVSQQ  360
VKWLRCVFVL TSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-2418161140NO APICAL MERISTEM PROTEIN
1ut4_B1e-2418161140NO APICAL MERISTEM PROTEIN
1ut7_A1e-2418161140NO APICAL MERISTEM PROTEIN
1ut7_B1e-2418161140NO APICAL MERISTEM PROTEIN
3swm_A1e-2418164143NAC domain-containing protein 19
3swm_B1e-2418164143NAC domain-containing protein 19
3swm_C1e-2418164143NAC domain-containing protein 19
3swm_D1e-2418164143NAC domain-containing protein 19
3swp_A1e-2418164143NAC domain-containing protein 19
3swp_B1e-2418164143NAC domain-containing protein 19
3swp_C1e-2418164143NAC domain-containing protein 19
3swp_D1e-2418164143NAC domain-containing protein 19
4dul_A1e-2418161140NAC domain-containing protein 19
4dul_B1e-2418161140NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009758643.10.0PREDICTED: NAC domain-containing protein 89-like
RefseqXP_016449980.10.0PREDICTED: NAC domain-containing protein 89-like
TrEMBLM1A5E50.0M1A5E5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000150770.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44290.15e-45NAC domain containing protein 60